PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc05g015550.1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family NF-YB
Protein Properties Length: 220aa    MW: 24498 Da    PI: 5.3403
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc05g015550.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB132.71.2e-4149141395
               NF-YB   3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrel 93 
                         e drf+Pi nv+rim+++lP +a is+++k  vqec+sefi+fvt++a+d cq+e+r+ti ++dll al ++Gf+dy+epl++yl++yre+
  Solyc05g015550.1.1  49 EADRFMPIENVVRIMRNILPPHAMISDESKVAVQECISEFIGFVTDQANDDCQHEQRNTIMAEDLLSALKKIGFDDYIEPLTLYLHRYREV 139
                         78****************************************************************************************9 PP

               NF-YB  94 eg 95 
                         +g
  Solyc05g015550.1.1 140 DG 141
                         87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.109.0E-3947147IPR009072Histone-fold
SuperFamilySSF471132.19E-3151145IPR009072Histone-fold
PfamPF008081.4E-1953117IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006154.4E-108199No hitNo description
PRINTSPR006154.4E-10100118No hitNo description
PRINTSPR006154.4E-10119137No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 220 aa     Download sequence    Send to blast
MKPVGGVVSV TIKFCRLLIR GTERGLRQAI LLHPTNPSNL EDFICPFPEA DRFMPIENVV  60
RIMRNILPPH AMISDESKVA VQECISEFIG FVTDQANDDC QHEQRNTIMA EDLLSALKKI  120
GFDDYIEPLT LYLHRYREVD GGADRSLKRE SLLLKRPMVC PASGYSITPN HLPPNLDMNH  180
PPPMGDDFMK EDASNTSTSR CTVSTVDNEV NSLAKGGKE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A7e-3047138293NF-YB
4awl_B8e-3047138394NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A8e-3047138394NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4g91_B8e-3048138292Transcription factor HapC (Eurofung)
4g92_B8e-3048138292Transcription factor HapC (Eurofung)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010321196.11e-146PREDICTED: nuclear transcription factor Y subunit B-6-like
SwissprotQ84W663e-46NFYB6_ARATH; Nuclear transcription factor Y subunit B-6
TrEMBLK4BYS11e-163K4BYS1_SOLLC; Uncharacterized protein
STRINGSolyc05g015550.1.11e-163(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11124356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47670.21e-47nuclear factor Y, subunit B6
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]